| Edit |   |
| Antigenic Specificity | TAPP1/PLEKHA1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TAPP1/PLEKHA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TAPP1/PLEKHA1. This antibody reacts with human. The TAPP1/PLEKHA1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to PLEKHA1(pleckstrin homology domain containing, family A member 1) Antibody(against the N terminal of PLEKHA1. Peptide sequence LNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQ. |
| Other Names | family A (phosphoinositide bindingspecific) member 1, PH domain-containing family A member 1, pleckstrin homology domain containing, family A (phosphoinositide bindingspecific) member 1 |
| Gene, Accession # | PLEKHA1, Gene ID: 59338, Accession: Q9HB21, SwissProt: Q9HB21 |
| Catalog # | NBP1-57653 |
| Price | |
| Order / More Info | TAPP1/PLEKHA1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |