| 产品详情 |
| Edit |   |
| Antigenic Specificity | integrin beta 4 binding protein |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The integrin beta 4 binding protein Antibody from Novus Biologicals is a rabbit polyclonal antibody to integrin beta 4 binding protein. This antibody reacts with human, mouse, rat. The integrin beta 4 binding protein Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat integrin beta 4 binding protein antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGS YCVFSNQGGLVHPKTSIEDQDELSSLLQVP |
| Other Names | b(2)gcn, B(2)GCN homolog, B4 integrin interactor, CAB, EIF3Ap27(BBP), eIF-6, eukaryotic translation initiation factor 3A, eukaryotic translation initiation factor 6, ITGB4BPintegrin beta 4 binding protein, p27 beta-4 integrin-binding protein, p27BBP |
| Gene, Accession # | EIF6, Gene ID: 3692 |
| Catalog # | NBP2-13954 |
| Price | |
| Order / More Info | integrin beta 4 binding protein Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 27119753 |
| 产品资料 |
|
|