| Edit |   |
|---|
| Antigenic Specificity | Integrin beta 8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Integrin beta 8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Integrin beta 8. This antibody reacts with human. The Integrin beta 8 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to ITGB8(integrin, beta 8) The peptide sequence was selected from the C terminal of ITGB8. Peptide sequence CTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCAL. |
|---|
| Other Names | integrin beta-8, integrin, beta 8 |
|---|
| Gene, Accession # | ITGB8, Gene ID: 3696, Accession: P26012, SwissProt: P26012 |
|---|
| Catalog # | NBP1-59269 |
|---|
| Price | |
|---|
| Order / More Info | Integrin beta 8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|