| Edit |   |
|---|
| Antigenic Specificity | Integrin beta 8 |
|---|
| Clone | CL7290 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Integrin beta 8 Antibody (CL7290) from Novus Biologicals is a mouse monoclonal antibody to Integrin beta 8. This antibody reacts with human. The Integrin beta 8 Antibody (CL7290) has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHY |
|---|
| Other Names | integrin beta-8, integrin, beta 8 |
|---|
| Gene, Accession # | ITGB8, Gene ID: 3696 |
|---|
| Catalog # | NBP2-76480 |
|---|
| Price | |
|---|
| Order / More Info | Integrin beta 8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|