| Edit |   |
|---|
| Antigenic Specificity | CCDC63 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCDC63 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC63. This antibody reacts with human. The CCDC63 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human CCDC63. Peptide sequence: EQSSQAYEQRVEAMARMAAMKDRQKKDTSQYNLEIRELERLYAHESKLKS |
|---|
| Other Names | coiled-coil domain containing 63, FLJ35843 |
|---|
| Gene, Accession # | CCDC63, Gene ID: 160762, Accession: NP_689804, SwissProt: NP_689804 |
|---|
| Catalog # | NBP1-91440-20ul |
|---|
| Price | |
|---|
| Order / More Info | CCDC63 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|