| Edit |   |
|---|
| Antigenic Specificity | CCDC60 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCDC60 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC60. This antibody reacts with human. The CCDC60 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CCDC60(coiled-coil domain containing 60) The peptide sequence was selected from the C terminal of CCDC60. Peptide sequence RPAKKILVKLQKFGENLDLRIRPHVLLKVLQDLRIWELCSPDIAVAIEFV. |
|---|
| Other Names | coiled-coil domain containing 60, coiled-coil domain-containing protein 60, MGC39827 |
|---|
| Gene, Accession # | CCDC60, Gene ID: 160777, Accession: Q8IWA6, SwissProt: Q8IWA6 |
|---|
| Catalog # | NBP1-56747-20ul |
|---|
| Price | |
|---|
| Order / More Info | CCDC60 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|