| Edit |   |
| Antigenic Specificity | CCDC54 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CCDC54 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC54. This antibody reacts with human. The CCDC54 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CCDC54(coiled-coil domain containing 54) The peptide sequence was selected from the N terminal of CCDC54. Peptide sequence MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLH. |
| Other Names | coiled-coil domain containing 54, coiled-coil domain-containing protein 54, FLJ25362, NYD-SP17, testes development-related NYD-SP17, Testis development protein NYD-SP17 |
| Gene, Accession # | CCDC54, Gene ID: 84692, Accession: Q8NEL0, SwissProt: Q8NEL0 |
| Catalog # | NBP1-56379 |
| Price | |
| Order / More Info | CCDC54 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |