| Edit |   |
|---|
| Antigenic Specificity | CCDC46 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCDC46 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC46. This antibody reacts with human. The CCDC46 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human CCDC46The immunogen for this antibody is CCDC46. Peptide sequence IEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFED. |
|---|
| Other Names | coiled-coil domain containing 46, coiled-coil domain-containing protein 46, FLJ39610, MGC33887 |
|---|
| Gene, Accession # | CEP112, Gene ID: 201134, Accession: NP_001032402, SwissProt: NP_001032402 |
|---|
| Catalog # | NBP1-79545 |
|---|
| Price | |
|---|
| Order / More Info | CCDC46 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|