| Edit |   |
|---|
| Antigenic Specificity | CCDC38 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCDC38 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC38. This antibody reacts with human. The CCDC38 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CCDC38(coiled-coil domain containing 38) The peptide sequence was selected from the N terminal of CCDC38. Peptide sequence RERQLKKAEKKLQDDALAFEEFLRENDQRSVDALKMAAQETINKLQMTAE. |
|---|
| Other Names | coiled-coil domain containing 38, coiled-coil domain-containing protein 38, FLJ40089 |
|---|
| Gene, Accession # | CCDC38, Gene ID: 120935, Accession: Q502W7, SwissProt: Q502W7 |
|---|
| Catalog # | NBP1-56363-20ul |
|---|
| Price | |
|---|
| Order / More Info | CCDC38 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|