| Edit |   |
| Antigenic Specificity | CCDC37 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CCDC37 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC37. This antibody reacts with human. The CCDC37 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CCDC37 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PSANPFHLSGDVDFFLLRDQERNKALSERQQQKTMRVHQKMTYSSKVSAK HTSLRRQLQLEDKQEDLEARAEAEHQRAFRDYTTWKL |
| Other Names | coiled-coil domain containing 37, coiled-coil domain-containing protein 37, FLJ40083, MGC120558 |
| Gene, Accession # | CCDC37, Gene ID: 348807 |
| Catalog # | NBP2-14449 |
| Price | |
| Order / More Info | CCDC37 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |