| Edit |   |
|---|
| Antigenic Specificity | CCDC25 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCDC25 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC25. This antibody reacts with human. The CCDC25 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CCDC25(coiled-coil domain containing 25) The peptide sequence was selected from the middle region of CCDC25. Peptide sequence DLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKV. |
|---|
| Other Names | coiled-coil domain containing 25, coiled-coil domain-containing protein 25, FLJ10853 |
|---|
| Gene, Accession # | CCDC25, Gene ID: 55246, Accession: Q86WR0, SwissProt: Q86WR0 |
|---|
| Catalog # | NBP1-56660 |
|---|
| Price | |
|---|
| Order / More Info | CCDC25 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|