| Edit |   |
| Antigenic Specificity | CCDC24 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CCDC24 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC24. This antibody reacts with human. The CCDC24 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CCDC24 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IIKDQLNVSNIDQVARHLRGLLEEECHTLEREILILQRCLEEEYLRPCHPSEAALEPTLAELKEQKKAMEQEL |
| Other Names | Coiled-Coil Domain Containing 24, Coiled-Coil Domain-Containing Protein 24, RP5-1198O20.2 |
| Gene, Accession # | CCDC24, Gene ID: 149473 |
| Catalog # | NBP2-56417 |
| Price | |
| Order / More Info | CCDC24 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |