| Edit |   |
| Antigenic Specificity | SAAL1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SAAL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SAAL1. This antibody reacts with human. The SAAL1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to SAAL1 (serum amyloid A-like 1) The peptide sequence was selected from the N terminal of SAAL1. Peptide sequence MDRNPSPPPPGRDKEEEEEVAGGDCIGSTVYSKHWLFGVLSGLIQIVSPE. |
| Other Names | FLJ41463, protein SAAL1, serum amyloid A-like 1 |
| Gene, Accession # | SAAL1, Gene ID: 113174, Accession: Q96ER3, SwissProt: Q96ER3 |
| Catalog # | NBP1-57062-20ul |
| Price | |
| Order / More Info | SAAL1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |