| Edit |   |
|---|
| Antigenic Specificity | Aldo-Keto Reductase Family 1, Member B1 (Aldose Reductase) (AKR1B1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | AKR1B1 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. |
|---|
| Immunogen | AKR1 B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI |
|---|
| Other Names | AR|akr1b7|ALR1|Akr1a4|2610201A18Rik|ADR|ALDR1|ALR2|zgc:86611|ALDRED|ALR-P-I|Akr1b3|Akr1b4|Aldr1|Alr|RATALDRED|Ahr-1|Ahr1|Akr1b1|Aldor1 |
|---|
| Gene, Accession # | Gene ID: 231 |
|---|
| Catalog # | ABIN629644 |
|---|
| Price | |
|---|
| Order / More Info | Aldo-Keto Reductase Family 1, Member B1 (Aldose Reductase) (AKR1B1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|