| 产品详情 |
| Edit |   |
| Antigenic Specificity | Enah/Vasp-like |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Enah/Vasp-like Antibody from Novus Biologicals is a rabbit polyclonal antibody to Enah/Vasp-like. This antibody reacts with human. The Enah/Vasp-like Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Enah/Vasp-like antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SNSVEKPVSSILSRMKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVKEEIIDAIRQELSGI |
| Other Names | ena/VASP-like protein, Enah/Vasp-like, RNB6Ena/vasodilator-stimulated phosphoprotein-like |
| Gene, Accession # | EVL, Gene ID: 51466 |
| Catalog # | NBP2-38132 |
| Price | |
| Order / More Info | Enah/Vasp-like Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|