| Edit |   |
| Antigenic Specificity | EMX2 |
| Clone | 4F7 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2b kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against recombinant protein on ELISA. It has been used for IHC-P. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The EMX2 Antibody (4F7) from Novus Biologicals is a mouse monoclonal antibody to EMX2. This antibody reacts with human. The EMX2 Antibody (4F7) has been validated for the following applications: ELISA, Immunohistochemistry-Paraffin. |
| Immunogen | EMX2 (NP_004089, 103 a.a. - 200 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKV |
| Other Names | empty spiracles homeobox 2, Empty spiracles homolog 2, empty spiracles homolog 2 (Drosophila), Empty spiracles-like protein 2, homeobox protein EMX2 |
| Gene, Accession # | EMX2, Gene ID: 2018, Accession: NP_004089, SwissProt: NP_004089 |
| Catalog # | H00002018-M06 |
| Price | |
| Order / More Info | EMX2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 25327963 |