| Edit |   |
|---|
| Antigenic Specificity | Emx1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Emx1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Emx1. This antibody reacts with human. The Emx1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human EMX1The immunogen for this antibody is EMX1. Peptide sequence DGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSL. |
|---|
| Other Names | empty spiracles homeobox 1, empty spiracles-like protein 1 |
|---|
| Gene, Accession # | EMX1, Gene ID: 2016, Accession: NP_004088, SwissProt: NP_004088 |
|---|
| Catalog # | NBP1-79221 |
|---|
| Price | |
|---|
| Order / More Info | Emx1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|