| Edit |   |
|---|
| Antigenic Specificity | Steroid Sulfatase (Microsomal), Isozyme S (STS) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosis. |
|---|
| Immunogen | STS antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY |
|---|
| Other Names | abcg2|ArsC|ARSC|ARSC1|ASC|ES|SSDD|XLI |
|---|
| Gene, Accession # | Gene ID: 412 |
|---|
| Catalog # | ABIN636085 |
|---|
| Price | |
|---|
| Order / More Info | Steroid Sulfatase (Microsomal), Isozyme S (STS) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|