| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPIG |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPIG Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPIG. This antibody reacts with human. The PPIG Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PPIG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKNEKEKKVKDHKSNSKERDIRRNSEKEDKYKNKVKKRAKSKS |
|---|
| Other Names | CARS-cyclophilin, CARS-CypPPIase G, CASP10, Clk-associating RS-cyclophilin, Cyclophilin G, CYP, EC 5.2.1.8, MGC133241, peptidyl-prolyl cis-trans isomerase G, Peptidyl-prolyl isomerase G, peptidylprolyl isomerase G (cyclophilin G), peptidyl-prolyl isomerase G (cyclophilin G), Rotamase G, SCAF10, SR-cyclophilin, SRcyp, SR-cyp, SR-related CTD-associated factor 10 |
|---|
| Gene, Accession # | PPIG, Gene ID: 9360 |
|---|
| Catalog # | NBP2-49256 |
|---|
| Price | |
|---|
| Order / More Info | PPIG Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|