| Edit |   |
|---|
| Antigenic Specificity | DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 49 (DDX49) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, dog |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of Anti-DDX49 has not yet been determined. |
|---|
| Immunogen | DDX49 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR |
|---|
| Other Names | MGC76291|r27090_2|DDX49|wu:fb82g04|wu:fd12e05|ddx49-a|R27090_2 |
|---|
| Gene, Accession # | Gene ID: 54555,484814,234374 |
|---|
| Catalog # | ABIN629881 |
|---|
| Price | |
|---|
| Order / More Info | DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 49 (DDX49) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|