Edit |   |
Antigenic Specificity | HSD3B7 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 84%, rat 84%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human HSD3B7 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LVLYAPLLNPYTLAVANTTFTVSTDKAQRHFGYEPLFSWEDSRTRTILWVQAATGSAQ |
Other Names | hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7, C(27)-3BETA-HSD, SDR11E3 |
Gene, Accession # | Gene ID: 80270, UniProt: Q9H2F3, ENSG00000099377 |
Catalog # | HPA060847 |
Price | |
Order / More Info | HSD3B7 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |