| Edit |   |
| Antigenic Specificity | MPHOSPH10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MPHOSPH10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MPHOSPH10. This antibody reacts with human. The MPHOSPH10 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MPHOSPH10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RLTLDHEKSKLSLAEIYEQEYIKLNQQKTAEEENPEHVEIQKMMDSLFLKLDALSNFHFIPKPPVPEIKVVSNLPAITMEEVAPVSVSDAALLA |
| Other Names | M phase phosphoprotein 10, M-phase phosphoprotein 10 (U3 small nucleolar ribonucleoprotein), MPP10CT90, MPP10P, U3 small nucleolar ribonucleoprotein protein MPP10 |
| Gene, Accession # | MPHOSPH10, Gene ID: 10199, Accession: O00566, SwissProt: O00566 |
| Catalog # | NBP2-38232 |
| Price | |
| Order / More Info | MPHOSPH10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |