| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MPG |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MPG Antibody from Novus Biologicals is a rabbit polyclonal antibody to MPG. This antibody reacts with human. The MPG Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MPG(N-methylpurine-DNA glycosylase) The peptide sequence was selected from the C terminal of MPG. Peptide sequence LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA. |
|---|
| Other Names | 3' end of the Mid1 gene, localized 68 kb upstream the humanzeta globin gene on16p, 3-alkyladenine DNA glycosylase, 3-methyladenine DNA glycosidase, AAG, ADPG, ANPG, APNG, CRA36.1, CRA36.1 (3-methyl-adenine DNA glycosylase), DNA-3-methyladenine glycosylase, EC 3.2.2.21, MDGalkyladenine DNA glycosylase, Mid1, N-methylpurine-DNA glycosylase, MPG, N-methylpurine-DNA glycosylasePIG16, PIG11, proliferation-inducing protein 11, proliferation-inducing protein 16 |
|---|
| Gene, Accession # | MPG, Gene ID: 4350, Accession: Q5J9I4, SwissProt: Q5J9I4 |
|---|
| Catalog # | NBP1-59730-20ul |
|---|
| Price | |
|---|
| Order / More Info | MPG Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|