| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MPG |
|---|
| Clone | 4B12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MPG Antibody (4B12) from Novus Biologicals is a mouse monoclonal antibody to MPG. This antibody reacts with human. The MPG Antibody (4B12) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | MPG (AAH14991, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPARSGAQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPA |
|---|
| Other Names | 3' end of the Mid1 gene, localized 68 kb upstream the humanzeta globin gene on16p, 3-alkyladenine DNA glycosylase, 3-methyladenine DNA glycosidase, AAG, ADPG, ANPG, APNG, CRA36.1, CRA36.1 (3-methyl-adenine DNA glycosylase), DNA-3-methyladenine glycosylase, EC 3.2.2.21, MDGalkyladenine DNA glycosylase, Mid1, N-methylpurine-DNA glycosylase, MPG, N-methylpurine-DNA glycosylasePIG16, PIG11, proliferation-inducing protein 11, proliferation-inducing protein 16 |
|---|
| Gene, Accession # | MPG, Gene ID: 4350, Accession: AAH14991, SwissProt: AAH14991 |
|---|
| Catalog # | H00004350-M08 |
|---|
| Price | |
|---|
| Order / More Info | MPG Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|