| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GCFC2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GCFC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GCFC2. This antibody reacts with human. The GCFC2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human GCFC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('ESEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETSEESQEDEKQDTWEQQQMRKAVKIIEERDIDLSCGSGSSKVKKFDTSISFP',) |
|---|
| Other Names | C2orf3, chromosome 2 open reading frame 3, DNABF, GC bindng factor, GCF, GCFGC binding factor, GC-rich sequence DNA-binding factor, GC-rich sequence DNA-binding factor 2, TCF9, TCF-9, Transcription factor 9, transcription factor 9 (binds GC-rich sequences) |
|---|
| Gene, Accession # | GCFC2, Gene ID: 6936 |
|---|
| Catalog # | NBP2-58823 |
|---|
| Price | |
|---|
| Order / More Info | GCFC2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|