| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GCC185 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GCC185 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GCC185. This antibody reacts with human. The GCC185 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human GCC185 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KLLSQQELVPELENTIKNLQEKNGVYLLSLSQRDTMLKELEGKINSLTEEKDDFINKLKNSHEEMDNFHKKCEREERLILELGKKVEQTIQYNS |
|---|
| Other Names | 185 kDa Golgi coiled-coil protein, CLL-associated antigen KW-11, CTCL tumor antigen se1-1, GCC protein, 185-kD, GCC185GRIP and coiled-coil domain-containing 2, Golgi coiled-coil protein GCC185, GRIP and coiled-coil domain containing 2, GRIP and coiled-coil domain-containing protein 2, KIAA0336REN53, Ran-binding protein 2-like 4, RANBP2L4, Renal carcinoma antigen NY-REN-53 |
|---|
| Gene, Accession # | GCC2, Gene ID: 9648, Accession: Q8IWJ2, SwissProt: Q8IWJ2 |
|---|
| Catalog # | NBP2-38267 |
|---|
| Price | |
|---|
| Order / More Info | GCC185 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|