| 产品详情 |
| Edit |   |
| Antigenic Specificity | Nav1.7 |
| Clone | 5A11 |
| Host Species | Mouse |
| Reactive Species | human, rat |
| Isotype | IgG2b kappa |
| Format | Protein A purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Nav1.7 Antibody (5A11) from Novus Biologicals is a mouse monoclonal antibody to Nav1.7. This antibody reacts with human, rat. The Nav1.7 Antibody (5A11) has been validated for the following applications: Western Blot, ELISA. |
| Immunogen | SCN9A (NP_002968 269 a.a. - 339 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDY |
| Other Names | ETHA, FEB3B, NE-NA, NENAVoltage-gated sodium channel subunit alpha Nav1.7, Neuroendocrine sodium channel, Peripheral sodium channel 1, PN1hNE-Na, sodium channel protein type 9 subunit alpha, Sodium channel protein type IX subunit alpha, sodium channel, voltage-gated, type IX, alpha subunit, voltage-gated sodium channel alpha subunit Nav1.7, voltage-gated, type IX, alpha polypeptide |
| Gene, Accession # | SCN9A, Gene ID: 6335, Accession: NP_002968, SwissProt: NP_002968 |
| Catalog # | H00006335-M01 |
| Price | |
| Order / More Info | Nav1.7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|