| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Nav1.7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Nav1.7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Nav1.7. This antibody reacts with human. The Nav1.7 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Nav1 |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RAYRRYRLRQNVKNISSIYIKDGDRDDDLLNKKDMAFDNVNENSSP |
|---|
| Other Names | ETHA, FEB3B, NE-NA, NENAVoltage-gated sodium channel subunit alpha Nav1.7, Neuroendocrine sodium channel, Peripheral sodium channel 1, PN1hNE-Na, sodium channel protein type 9 subunit alpha, Sodium channel protein type IX subunit alpha, sodium channel, voltage-gated, type IX, alpha subunit, voltage-gated sodium channel alpha subunit Nav1.7, voltage-gated, type IX, alpha polypeptide |
|---|
| Gene, Accession # | SCN9A, Gene ID: 6335 |
|---|
| Catalog # | NBP2-57651 |
|---|
| Price | |
|---|
| Order / More Info | Nav1.7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|