| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Nav1.6 |
|---|
| Clone | 4G7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against cell lysate and recombinant protein for WB. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Nav1.6 Antibody (4G7) from Novus Biologicals is a mouse monoclonal antibody to Nav1.6. This antibody reacts with human. The Nav1.6 Antibody (4G7) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | SCN8A (NP_055006 1854 a.a. - 1951 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVT |
|---|
| Other Names | CerIII, hNa6/Scn8a voltage-gated sodium channel, MED, NaCh6, Nav1.6, PN4, sodium channel protein type 8 subunit alpha, Sodium channel protein type VIII subunit alpha, sodium channel, voltage gated, type VIII, alpha polypeptide, sodium channel, voltage gated, type VIII, alpha subunit, Voltage-gated sodium channel subunit alpha Nav1.6 |
|---|
| Gene, Accession # | SCN8A, Gene ID: 6334, Accession: NP_055006, SwissProt: NP_055006 |
|---|
| Catalog # | H00006334-M04 |
|---|
| Price | |
|---|
| Order / More Info | Nav1.6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 17537961 |
|---|
| 产品资料 |
|
|