| 产品详情 |
| Edit |   |
| Antigenic Specificity | KCNN4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KCNN4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KCNN4. This antibody reacts with human. The KCNN4 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human KCNN4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK |
| Other Names | hIKCa1, hKCa4, hSK4, IK1, IKCa1, intermediate conductance calcium-activated potassium channel protein 4, KCa3.1IKCA1, KCa4, KCA4SKCa4, potassium intermediate/small conductance calcium-activated channel, subfamilyN, member 4, putative erythrocyte intermediate conductance calcium-activated potassiumGardos channel, Putative Gardos channel, SK4SKCa 4 |
| Gene, Accession # | KCNN4, Gene ID: 3783, Accession: O15554, SwissProt: O15554 |
| Catalog # | NBP2-33694 |
| Price | |
| Order / More Info | KCNN4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 25848765 |
| 产品资料 |
|
|