| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Ficolin-2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Ficolin-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ficolin-2. This antibody reacts with human. The Ficolin-2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to FCN2(ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin)) The peptide sequence was selected from the N terminal of FCN2. Peptide sequence RGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHT |
|---|
| Other Names | 37 kDa elastin-binding protein, Collagen/fibrinogen domain-containing protein 2, EBP-37ficolin (collagen/fibrinogen domain-containing lectin) 2 (hucolin), FCNLficolin B, ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin), ficolin-2, Ficolin-B, Ficolin-beta, Hucolin, L-ficolin, P35, Serum lectin p35 |
|---|
| Gene, Accession # | FCN2, Gene ID: 2220, Accession: Q15485, SwissProt: Q15485 |
|---|
| Catalog # | NBP1-60121-20ul |
|---|
| Price | |
|---|
| Order / More Info | Ficolin-2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|