| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IFN-gamma R2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IFN-gamma R2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IFN-gamma R2. This antibody reacts with human. The IFN-gamma R2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to IFNGR2(interferon gamma receptor 2 (interferon gamma transducer 1)) The peptide sequence was selected from the middle region of IFNGR2. Peptide sequence WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL |
|---|
| Other Names | AF-1interferon-gamma receptor beta chain precursor10IFNGT1Interferon gamma receptor accessory factor 1, IFGR2, IFN-gamma receptor 2, IFN-gamma-R2, interferon gamma receptor 2, interferon gamma receptor 2 (interferon gamma transducer 1), interferon gamma receptor accessory factor-1, interferon gamma receptor beta chain, Interferon gamma transducer 1 |
|---|
| Gene, Accession # | IFNGR2, Gene ID: 3460, Accession: P38484, SwissProt: P38484 |
|---|
| Catalog # | NBP1-59795 |
|---|
| Price | |
|---|
| Order / More Info | IFN-gamma R2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|