| Edit |   |
|---|
| Antigenic Specificity | ZNF131 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF131 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF131. This antibody reacts with human. The ZNF131 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human ZNF131The immunogen for this antibody is ZNF131. Peptide sequence DLLQDSQVHDSHMSELPEQVQVSYLEVGRIQTEEGTEVHVEELHVERVNQ. |
|---|
| Other Names | pHZ-10, zinc finger protein 131, zinc finger protein 131 (clone pHZ-10) |
|---|
| Gene, Accession # | ZNF131, Gene ID: 7690, Accession: NP_003423, SwissProt: NP_003423 |
|---|
| Catalog # | NBP1-79227 |
|---|
| Price | |
|---|
| Order / More Info | ZNF131 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|