| Edit |   |
| Antigenic Specificity | XP32 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 25ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The XP32 Antibody from Novus Biologicals is a rabbit polyclonal antibody to XP32. This antibody reacts with human. The XP32 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PCSTSYCCLAPRTFGVSPLRRWIQRPQNCNTGSSGCCENSGSSGCCGSGGCGCSCGCGSSG |
| Other Names | C1orf68, chromosome 1 open reading frame 68, LEP7, skin-specific protein (xp32), skin-specific protein 32, XP32 |
| Gene, Accession # | C1orf68, Gene ID: 100129271 |
| Catalog # | NBP1-93557-25ul |
| Price | |
| Order / More Info | XP32 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |