| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CPI17 alpha |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CPI17 alpha Antibody from Novus Biologicals is a rabbit polyclonal antibody to CPI17 alpha. This antibody reacts with human. The CPI17 alpha Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CPI17 alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLS |
|---|
| Other Names | 17 kDa PKC-potentiated inhibitory protein of PP1, CPI-1717-kDa PKC-potentiated inhibitory protein of PP1, CPI1717-KDa protein, PKC-potentiated inhibitory protein of PP1, PPP1INL, Protein kinase C-potentiated inhibitor protein of 17 kDa, protein phosphatase 1 regulatory subunit 14A, protein phosphatase 1, regulatory (inhibitor) subunit 14A |
|---|
| Gene, Accession # | PPP1R14A, Gene ID: 94274 |
|---|
| Catalog # | NBP2-58619 |
|---|
| Price | |
|---|
| Order / More Info | CPI17 alpha Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|