| Edit |   |
|---|
| Antigenic Specificity | VDR/NR1I1/Vitamin D Receptor |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VDR/NR1I1/Vitamin D Receptor Antibody from Novus Biologicals is a rabbit polyclonal antibody to VDR/NR1I1/Vitamin D Receptor. This antibody reacts with human. The VDR/NR1I1/Vitamin D Receptor Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human VDR/NR1I1/Vitamin D Receptor antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDP |
|---|
| Other Names | NR1I1Nuclear receptor subfamily 1 group I member 11,25-dihydroxyvitamin D3 receptor, vitamin D1,25- dihydroxyvitamin D3 receptor, vitamin D3 receptor |
|---|
| Gene, Accession # | VDR, Gene ID: 7421 |
|---|
| Catalog # | NBP2-55786 |
|---|
| Price | |
|---|
| Order / More Info | VDR/NR1I1/Vitamin D Receptor Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|