| Edit |   |
| Antigenic Specificity | TRAM1L1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TRAM1L1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRAM1L1. This antibody reacts with human. The TRAM1L1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TRAM1L1(translocation associated membrane protein 1-like 1) The peptide sequence was selected from the middle region of TRAM1L1. Peptide sequence LWAIVFILGRLVTLIVSVLTVGFHLAGSQNRNPDALTGNVNVLAAKIAVL. |
| Other Names | MGC26568, translocating chain-associated membrane protein 1-like 1, translocation associated membrane protein 1-like 1 |
| Gene, Accession # | TRAM1L1, Gene ID: 133022, Accession: Q8N609, SwissProt: Q8N609 |
| Catalog # | NBP1-60111 |
| Price | |
| Order / More Info | TRAM1L1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |