| Edit |   |
|---|
| Antigenic Specificity | TRAM2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRAM2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRAM2. This antibody reacts with human. The TRAM2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TRAM2(translocation associated membrane protein 2) The peptide sequence was selected from the N terminal of TRAM2. Peptide sequence MFEVTAKTAFLFILPQYNISVPTADSETVHYHYGPKDLVTILFYIFITII. |
|---|
| Other Names | KIAA0057TRAM-like protein, translocating chain-associated membrane protein 2, translocation associated membrane protein 2 |
|---|
| Gene, Accession # | TRAM2, Gene ID: 9697, Accession: Q15035, SwissProt: Q15035 |
|---|
| Catalog # | NBP1-59957-20ul |
|---|
| Price | |
|---|
| Order / More Info | TRAM2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|