| Edit |   |
| Antigenic Specificity | OGDHL |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The OGDHL Antibody from Novus Biologicals is a rabbit polyclonal antibody to OGDHL. This antibody reacts with human. The OGDHL Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human OGDHL. Peptide sequence VFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHKSWDSFFR. |
| Other Names | mitochondrial, OGDC-E1-like, oxoglutarate dehydrogenase-like |
| Gene, Accession # | OGDHL, Gene ID: 55753, Accession: NP_060715, SwissProt: NP_060715 |
| Catalog # | NBP1-91486 |
| Price | |
| Order / More Info | OGDHL Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 28720665 |