| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FERD3L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FERD3L Antibody from Novus Biologicals is a rabbit polyclonal antibody to FERD3L. This antibody reacts with human. The FERD3L Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FERD3L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAAYPESCVDTTVLDFVADLSLASPRRPLLCDFAPGVSLGDPALALREGRPRRMARFEEGDPEEEECEVDQ |
|---|
| Other Names | Basic helix-loop-helix protein N-twist, BHLHA31, bHLHa31NTWIST, Class A basic helix-loop-helix protein 31, Fer3-like (Drosophila), fer3-like protein, MGC119861, NATO3Neuronal twist, Nephew of atonal 3, N-TWIST |
|---|
| Gene, Accession # | FERD3L, Gene ID: 222894 |
|---|
| Catalog # | NBP1-91897 |
|---|
| Price | |
|---|
| Order / More Info | FERD3L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|