| Edit |   |
|---|
| Antigenic Specificity | Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3. This antibody reacts with human. The Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human HS6ST3. Peptide sequence TKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW. |
|---|
| Other Names | DKFZp761K2315, heparan sulfate 6-O-sulfotransferase 3 |
|---|
| Gene, Accession # | HS6ST3, Gene ID: 266722, Accession: NP_703157, SwissProt: NP_703157 |
|---|
| Catalog # | NBP1-91328 |
|---|
| Price | |
|---|
| Order / More Info | Heparan Sulfate 6-O-Sulfotransferase 3/HS6ST3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|