| Edit |   |
|---|
| Antigenic Specificity | PDXDC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PDXDC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDXDC1. This antibody reacts with human. The PDXDC1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PDXDC1(pyridoxal-dependent decarboxylase domain containing 1) The peptide sequence was selected from the N terminal of PDXDC1. Peptide sequence DEDEEPQSPRIQNIGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDT. |
|---|
| Other Names | EC 4.1.1.-, EC 4.1.1.50, KIAA0251EC 4.1.1, LP8165, pyridoxal-dependent decarboxylase domain containing 1, pyridoxal-dependent decarboxylase domain-containing protein 1 |
|---|
| Gene, Accession # | PDXDC1, Gene ID: 23042, Accession: Q6P996, SwissProt: Q6P996 |
|---|
| Catalog # | NBP1-56776 |
|---|
| Price | |
|---|
| Order / More Info | PDXDC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|