| Edit |   |
| Antigenic Specificity | RNF175 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RNF175 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNF175. This antibody reacts with human. The RNF175 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to RNF175(ring finger protein 175) The peptide sequence was selected from the middle region of RNF175. Peptide sequence YGLYYGVMGRDFAEICSDYMASTIGFYSVSRLPTRSLSDNICAVCGQKII. |
| Other Names | FLJ34190, ring finger protein 175 |
| Gene, Accession # | RNF175, Gene ID: 285533, Accession: Q8NB61, SwissProt: Q8NB61 |
| Catalog # | NBP1-55079 |
| Price | |
| Order / More Info | RNF175 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |