| Edit |   |
| Antigenic Specificity | RNF170 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RNF170 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNF170. This antibody reacts with human. The RNF170 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to RNF170(ring finger protein 170) The peptide sequence was selected from the middle region of RNF170. Peptide sequence CIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVLRLHQDINDY. |
| Other Names | DKFZP564A022, FLJ38306, Putative LAG1-interacting protein, ring finger protein 170 |
| Gene, Accession # | RNF170, Gene ID: 81790, Accession: Q96K19, SwissProt: Q96K19 |
| Catalog # | NBP1-59759 |
| Price | |
| Order / More Info | RNF170 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |