| Edit |   |
|---|
| Antigenic Specificity | RNF169 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RNF169 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNF169. This antibody reacts with human. The RNF169 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RNF169(ring finger protein 169) The peptide sequence was selected from the N terminal of RNF169 (NP_001092108). Peptide sequence DTETGKRKMDEQKKRDEPLVLKTNLERCPARLSDSENEEPSRGQMTQTHR. |
|---|
| Other Names | EC 3.4.24.57, KIAA1991EC 3.1.4.16, ring finger protein 169 |
|---|
| Gene, Accession # | RNF169, Gene ID: 254225, Accession: Q8NCN4, SwissProt: Q8NCN4 |
|---|
| Catalog # | NBP1-55084 |
|---|
| Price | |
|---|
| Order / More Info | RNF169 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|