| Edit |   |
|---|
| Antigenic Specificity | RNF166 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RNF166 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNF166. This antibody reacts with human. The RNF166 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human RNF166. Peptide sequence RVVCPICSAMPWGDPSYKSANFLQHLLHRHKFSYDTFVDYSIDEEAAFQA. |
|---|
| Other Names | MGC14381, MGC2647, ring finger protein 166 |
|---|
| Gene, Accession # | RNF166, Gene ID: 115992, Accession: NP_849163, SwissProt: NP_849163 |
|---|
| Catalog # | NBP1-80432-20ul |
|---|
| Price | |
|---|
| Order / More Info | RNF166 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|