| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RNF160 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RNF160 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNF160. This antibody reacts with human. The RNF160 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human RNF160 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ECLRFIMQQNLGEEEIEQMLVNDQLIPFIDAVLKDPGLQHGQLFNHLAETLSSWEAKADTEKDEKTAHNLENVLI |
|---|
| Other Names | C21orf10, C21orf98, E3 ubiquitin-protein ligase listerin, EC 6.3.2.-, KIAA0714ZNF294, listerin E3 ubiquitin protein ligase 1, RING finger protein 160LISTERIN, RNF160FLJ11053, Zinc finger protein 294chromosome 21 open reading frame 98 |
|---|
| Gene, Accession # | LTN1, Gene ID: 26046 |
|---|
| Catalog # | NBP2-57180 |
|---|
| Price | |
|---|
| Order / More Info | RNF160 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|