| 产品详情 |
| Edit |   |
| Antigenic Specificity | ARL8A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ARL8A Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARL8A. This antibody reacts with human, mouse, rat. The ARL8A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of ARL8A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS |
| Other Names | ADP-ribosylation factor-like 10B, ADP-ribosylation factor-like 8A, ADP-ribosylation factor-like protein 10B, ADP-ribosylation factor-like protein 8A, ARL10B, FLJ45195, GIE2, Novel small G protein indispensable for equal chromosome segregation 2, small G protein indispensable for equal chromosome segregation 2 |
| Gene, Accession # | ARL8A, Gene ID: 127829 |
| Catalog # | NBP2-14316 |
| Price | |
| Order / More Info | ARL8A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|