| Edit |   |
| Antigenic Specificity | ARL5A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ARL5A Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARL5A. This antibody reacts with human. The ARL5A Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ARL5A(ADP-ribosylation factor-like 5A) The peptide sequence was selected from the middle region of ARL5A. Peptide sequence YKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQA. |
| Other Names | ADP-ribosylation factor-like 5, ADP-ribosylation factor-like 5A, ADP-ribosylation factor-like protein 5A, ARFLP5, ARL5ADP-ribosylation factor-like protein 5 |
| Gene, Accession # | ARL5A, Gene ID: 26225, Accession: Q9Y689, SwissProt: Q9Y689 |
| Catalog # | NBP1-58304-20ul |
| Price | |
| Order / More Info | ARL5A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |