| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ARL17A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ARL17A Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARL17A. This antibody reacts with human. The ARL17A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ARL17A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acid sequence: IRPLWQHFFQNTKGARSPGSTHQGSLASGVLPIKCSHVEFGMWKGGRSH |
|---|
| Other Names | ADP Ribosylation Factor Like GTPase 17A, ADP-Ribosylation Factor 1 Pseudogene 2, ADP-Ribosylation Factor 7, ADP-Ribosylation Factor 7 Variant, ADP-Ribosylation Factor Like GTPase 17A, ADP-Ribosylation Factor-Like 17 Pseudogene 1, ADP-Ribosylation Factor-Like 17-Like, ADP-ribosylation factor-like protein 17, ARF1P2, ARL17A ARL17B, ARL17P1 |
|---|
| Gene, Accession # | ARL17A, Gene ID: 51326 |
|---|
| Catalog # | NBP2-59794 |
|---|
| Price | |
|---|
| Order / More Info | ARL17A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|